Lineage for d2hgaa1 (2hga A:23-125)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797796Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 797797Superfamily b.36.1: PDZ domain-like [50156] (6 families) (S)
    peptide-binding domain
  5. 798160Family b.36.1.6: MTH1368 C-terminal domain-like [159049] (1 protein)
    middle part of Pfam PF02163
  6. 798161Protein Uncharacterized protein MTH1368 [159050] (1 species)
  7. 798162Species Methanobacterium thermoautotrophicum [TaxId:145262] [159051] (1 PDB entry)
    Uniprot O27421 208-310
  8. 798163Domain d2hgaa1: 2hga A:23-125 [147282]

Details for d2hgaa1

PDB Entry: 2hga (more details)

PDB Description: solution nmr structure of conserved protein mth1368, northeast structural genomics consortium target tt821a
PDB Compounds: (A:) Conserved protein MTH1368

SCOP Domain Sequences for d2hgaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
qpdgvqidsvvpgspaskvltpglviesingmptsnlttysaalktisvgevinittdqg
tfhlktgrnpnnssraymgirtsnhlrvrdsvasvlgdtlpfa

SCOP Domain Coordinates for d2hgaa1:

Click to download the PDB-style file with coordinates for d2hgaa1.
(The format of our PDB-style files is described here.)

Timeline for d2hgaa1: