Class b: All beta proteins [48724] (180 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.6: MTH1368 C-terminal domain-like [159049] (1 protein) middle part of Pfam PF02163 |
Protein Uncharacterized protein MTH1368 [159050] (1 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [159051] (1 PDB entry) Uniprot O27421 208-310 |
Domain d2hgaa1: 2hga A:23-125 [147282] |
PDB Entry: 2hga (more details)
SCOPe Domain Sequences for d2hgaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} qpdgvqidsvvpgspaskvltpglviesingmptsnlttysaalktisvgevinittdqg tfhlktgrnpnnssraymgirtsnhlrvrdsvasvlgdtlpfa
Timeline for d2hgaa1: