Lineage for d2h73a_ (2h73 A:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.1: Thioltransferase [52834] (16 proteins) 
Protein Thioredoxin [52835] (15 species) 
Species Escherichia coli [TaxId:562] [52836] (46 PDB entries)
Uniprot P00274 ! Uniprot P00581
Domain d2h73a_: 2h73 A: [164994]
automated match to d1xoaa_
complexed with mpd; mutant
Details for d2h73a_
PDB Entry: 2h73 (more details), 2.45 Å
PDB Description: crystal structure of thioredoxin mutant d43e in hexagonal (p61) space group
PDB Compounds: (A:) thioredoxinSCOPe Domain Sequences for d2h73a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h73a_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapileeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
SCOPe Domain Coordinates for d2h73a_:
Click to download the PDB-style file with coordinates for d2h73a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2h73a_:
- d2h73a_ first appeared in SCOPe 2.01
- d2h73a_ appears in SCOPe 2.02
- d2h73a_ appears in SCOPe 2.04
- d2h73a_ appears in the current release, SCOPe 2.08
View in 3D
