Lineage for d2h73a_ (2h73 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 991975Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 992037Protein Thioredoxin [52835] (14 species)
  7. 992053Species Escherichia coli [TaxId:562] [52836] (44 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 992081Domain d2h73a_: 2h73 A: [164994]
    automated match to d1xoaa_
    complexed with mpd; mutant

Details for d2h73a_

PDB Entry: 2h73 (more details), 2.45 Å

PDB Description: crystal structure of thioredoxin mutant d43e in hexagonal (p61) space group
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2h73a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h73a_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapileeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOPe Domain Coordinates for d2h73a_:

Click to download the PDB-style file with coordinates for d2h73a_.
(The format of our PDB-style files is described here.)

Timeline for d2h73a_: