Lineage for d2h2ub_ (2h2u B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
consists of five 4-stranded beta-sheet motifs; meander
Superfamily b.67.3: Apyrase [101887] (1 family) 
distorted propeller with an alpha helix inserted between the second and third blades
automatically mapped to Pfam PF06079Family b.67.3.1: Apyrase [101888] (1 protein)
Pfam PF06079Protein Soluble calcium-activated nucleotidase SCAN-1 [101889] (1 species) Species Human (Homo sapiens) [TaxId:9606] [101890] (4 PDB entries) 
Domain d2h2ub_: 2h2u B: [204508]
automated match to d1s1da_
complexed with ca; mutant
Details for d2h2ub_
PDB Entry: 2h2u (more details), 2.4 Å
PDB Description: crystal structure of the e130y mutant of human soluble calcium- activated nucleotidase (scan) with calcium ion
PDB Compounds: (B:) Soluble calcium-activated nucleotidase 1SCOPe Domain Sequences for d2h2ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h2ub_ b.67.3.1 (B:) Soluble calcium-activated nucleotidase SCAN-1 {Human (Homo sapiens) [TaxId: 9606]}
nwyndtyplsppqrtpagiryriaviadldtesraqeentwfsylkkgyltlsdsgdkva
vewdkdhgvleshlaykgrgmelsdlivfngklysvddrtgvvyqiegskavpwvilsdg
dgtvekgfkaewlavkderlyvgglgkewttttgdvvnenpewvkvvgykgsvdhenwvs
nynalraaagiqppgylihesacwsdtlqrwfflprrasqerysekdderkganlllsas
pdfgdiavshvgavvpthgfssfkfipntddqiivalkseedsgrvasyimaftldgrfl
lpetkigsvkyegiefi
SCOPe Domain Coordinates for d2h2ub_:
Click to download the PDB-style file with coordinates for d2h2ub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2h2ub_:
- d2h2ub_ first appeared in SCOPe 2.03
- d2h2ub_ appears in SCOPe 2.07
View in 3D
