PDB entry 2h2u

View 2h2u on RCSB PDB site
Description: Crystal structure of the E130Y mutant of human soluble calcium-activated nucleotidase (SCAN) with calcium ion
Class: hydrolase
Keywords: nucleotidase, five-blade beta propeller, calcium-binding protein, nucleotide-binding, hydrolase
Deposited on 2006-05-19, released 2006-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble calcium-activated nucleotidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CANT1, SHAPY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WVQ1 (Start-338)
      • engineered (97)
    Domains in SCOPe 2.08: d2h2ua_
  • Chain 'B':
    Compound: Soluble calcium-activated nucleotidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CANT1, SHAPY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WVQ1 (Start-338)
      • engineered (97)
    Domains in SCOPe 2.08: d2h2ub_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h2uA (A:)
    gshmasppthnahnwrlgqapanwyndtyplsppqrtpagiryriaviadldtesraqee
    ntwfsylkkgyltlsdsgdkvavewdkdhgvleshlaykgrgmelsdlivfngklysvdd
    rtgvvyqiegskavpwvilsdgdgtvekgfkaewlavkderlyvgglgkewttttgdvvn
    enpewvkvvgykgsvdhenwvsnynalraaagiqppgylihesacwsdtlqrwfflprra
    sqerysekdderkganlllsaspdfgdiavshvgavvpthgfssfkfipntddqiivalk
    seedsgrvasyimaftldgrfllpetkigsvkyegiefi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h2uA (A:)
    yndtyplsppqrtpagiryriaviadldtesraqeentwfsylkkgyltlsdsgdkvave
    wdkdhgvleshlaykgrgmelsdlivfngklysvddrtgvvyqiegskavpwvilsdgdg
    tvekgfkaewlavkderlyvgglgkewttttgdvvnenpewvkvvgykgsvdhenwvsny
    nalraaagiqppgylihesacwsdtlqrwfflprrasqerysekdderkganlllsaspd
    fgdiavshvgavvpthgfssfkfipntddqiivalkseedsgrvasyimaftldgrfllp
    etkigsvkyegiefi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h2uB (B:)
    gshmasppthnahnwrlgqapanwyndtyplsppqrtpagiryriaviadldtesraqee
    ntwfsylkkgyltlsdsgdkvavewdkdhgvleshlaykgrgmelsdlivfngklysvdd
    rtgvvyqiegskavpwvilsdgdgtvekgfkaewlavkderlyvgglgkewttttgdvvn
    enpewvkvvgykgsvdhenwvsnynalraaagiqppgylihesacwsdtlqrwfflprra
    sqerysekdderkganlllsaspdfgdiavshvgavvpthgfssfkfipntddqiivalk
    seedsgrvasyimaftldgrfllpetkigsvkyegiefi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h2uB (B:)
    nwyndtyplsppqrtpagiryriaviadldtesraqeentwfsylkkgyltlsdsgdkva
    vewdkdhgvleshlaykgrgmelsdlivfngklysvddrtgvvyqiegskavpwvilsdg
    dgtvekgfkaewlavkderlyvgglgkewttttgdvvnenpewvkvvgykgsvdhenwvs
    nynalraaagiqppgylihesacwsdtlqrwfflprrasqerysekdderkganlllsas
    pdfgdiavshvgavvpthgfssfkfipntddqiivalkseedsgrvasyimaftldgrfl
    lpetkigsvkyegiefi