Lineage for d2gm6a1 (2gm6 A:11-202)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1558340Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1558815Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 1558816Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 1558844Species Ralstonia eutropha [TaxId:106590] [159289] (2 PDB entries)
    Uniprot Q46R41 11-202
  8. 1558846Domain d2gm6a1: 2gm6 A:11-202 [147130]
    complexed with edo, fe, so4

Details for d2gm6a1

PDB Entry: 2gm6 (more details), 1.84 Å

PDB Description: crystal structure of a putative cysteine dioxygenase type i (reut_b5045) from ralstonia eutropha jmp134 at 1.84 a resolution
PDB Compounds: (A:) Cysteine dioxygenase type I

SCOPe Domain Sequences for d2gm6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]}
slaplrefitglsalldeqpgearilreggallarlvarddwlpdafaqphpeyyqqmll
hcdsaerfsivsfvwgpgqrtpihdhtvwgligmlrgaeysqpfvldgsgrpvlhgeptr
lepghveavsptvgdihrvhnayddrvsisihvyganiggvrrsvyteagerkpfisgys
npylpnpwdrsk

SCOPe Domain Coordinates for d2gm6a1:

Click to download the PDB-style file with coordinates for d2gm6a1.
(The format of our PDB-style files is described here.)

Timeline for d2gm6a1: