Lineage for d2gk3e_ (2gk3 E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467497Family c.23.16.9: STM3548-like [159492] (2 proteins)
    Pfam PF07090; DUF1355
  6. 2467498Protein Putative cytoplasmic protein STM3548 [159493] (1 species)
  7. 2467499Species Salmonella typhimurium [TaxId:90371] [159494] (1 PDB entry)
    Uniprot Q8ZLF9 8-253
  8. 2467504Domain d2gk3e_: 2gk3 E: [147127]
    automated match to d2gk3a1
    complexed with gol

Details for d2gk3e_

PDB Entry: 2gk3 (more details), 2.25 Å

PDB Description: Cytoplasmic Protein STM3548 from Salmonella typhimurium
PDB Compounds: (E:) putative cytoplasmic protein

SCOPe Domain Sequences for d2gk3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gk3e_ c.23.16.9 (E:) Putative cytoplasmic protein STM3548 {Salmonella typhimurium [TaxId: 90371]}
kklkvlfigeswhihmihskgydsftsskyeegatwlleclrkggvdidympahtvqiaf
pesidelnrydvivisdigsntfllqnetfyqlkikpnalesikeyvkngggllmiggyl
sfmgieakanykntvlaevlpvimldgddrvekpegicaeavspehpvvngfsdypvflg
ynqavarddadvvltinndpllvfgeyqqgktacfmsdcsphwgtqqfmswpfytdlwvn
tlqfiark

SCOPe Domain Coordinates for d2gk3e_:

Click to download the PDB-style file with coordinates for d2gk3e_.
(The format of our PDB-style files is described here.)

Timeline for d2gk3e_: