Lineage for d2gjxa1 (2gjx A:167-528)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1340934Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 1340941Protein beta-hexosaminidase A [159387] (1 species)
  7. 1340942Species Human (Homo sapiens) [TaxId:9606] [159388] (2 PDB entries)
    Uniprot P06865 167-528
  8. 1340943Domain d2gjxa1: 2gjx A:167-528 [145202]
    Other proteins in same PDB: d2gjxa2, d2gjxb1, d2gjxb2, d2gjxc1, d2gjxc2, d2gjxd2, d2gjxe2, d2gjxf1, d2gjxf2, d2gjxg1, d2gjxg2, d2gjxh2
    complexed with nag, so4

Details for d2gjxa1

PDB Entry: 2gjx (more details), 2.8 Å

PDB Description: crystallographic structure of human beta-hexosaminidase a
PDB Compounds: (A:) Beta-hexosaminidase alpha chain

SCOPe Domain Sequences for d2gjxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
fphrgllldtsrhylplssildtldvmaynklnvfhwhlvddpsfpyesftfpelmrkgs
ynpvthiytaqdvkevieyarlrgirvlaefdtpghtlswgpgipglltpcysgsepsgt
fgpvnpslnntyefmstfflevssvfpdfylhlggdevdftcwksnpeiqdfmrkkgfge
dfkqlesfyiqtlldivssygkgyvvwqevfdnkvkiqpdtiiqvwredipvnymkelel
vtkagfrallsapwylnrisygpdwkdfyvveplafegtpeqkalviggeacmwgeyvdn
tnlvprlwpragavaerlwsnkltsdltfayerlshfrcellrrgvqaqplnvgfceqef
eq

SCOPe Domain Coordinates for d2gjxa1:

Click to download the PDB-style file with coordinates for d2gjxa1.
(The format of our PDB-style files is described here.)

Timeline for d2gjxa1: