SCOP 1.75: Domain d2gjxa1: 2gjx A:167-528

Lineage for d2gjxa1 (2gjx A:167-528)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (5 proteins)
   Glycosyl hydrolase family 20, GH20

6. Protein beta-hexosaminidase A [159387] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159388] (2 PDB entries)
   Uniprot P06865 167-528

8. Domain d2gjxa1: 2gjx A:167-528 [145202]
   Other proteins in same PDB: d2gjxa2, d2gjxb1, d2gjxb2, d2gjxc1, d2gjxc2, d2gjxd2, d2gjxe2, d2gjxf1, d2gjxf2, d2gjxg1, d2gjxg2, d2gjxh2
   complexed with bma, nag, ndg, so4

Details for d2gjxa1

PDB Entry: 2gjx, 2.8 Å

PDB Description: crystallographic structure of human beta-hexosaminidase a

PDB Compounds: (A:) Beta-hexosaminidase alpha chain

SCOP Domain Sequences for d2gjxa1:

Sequence; same for both SEQRES and ATOM records:

>d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
fphrgllldtsrhylplssildtldvmaynklnvfhwhlvddpsfpyesftfpelmrkgs
ynpvthiytaqdvkevieyarlrgirvlaefdtpghtlswgpgipglltpcysgsepsgt
fgpvnpslnntyefmstfflevssvfpdfylhlggdevdftcwksnpeiqdfmrkkgfge
dfkqlesfyiqtlldivssygkgyvvwqevfdnkvkiqpdtiiqvwredipvnymkelel
vtkagfrallsapwylnrisygpdwkdfyvveplafegtpeqkalviggeacmwgeyvdn
tnlvprlwpragavaerlwsnkltsdltfayerlshfrcellrrgvqaqplnvgfceqef
eq

Timeline for d2gjxa1:

• d2gjxa1 is new in SCOP 1.75
  
• d2gjxa1 appears in SCOPe 2.01
  
• d2gjxa1 appears in the current release, SCOPe 2.08