![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Probable acetyltransferase Atu2290 [143660] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [143661] (1 PDB entry) Uniprot Q8UD38 6-169 |
![]() | Domain d2ge3a1: 2ge3 A:6-169 [135044] Other proteins in same PDB: d2ge3b_, d2ge3c_, d2ge3d_ complexed with aco |
PDB Entry: 2ge3 (more details), 2.25 Å
SCOPe Domain Sequences for d2ge3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} dtvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpqfvaia dgdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglhriels vhadnaraialyekigfahegrardavsidghyidslnmaiifg
Timeline for d2ge3a1: