Lineage for d2gbza_ (2gbz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887529Species Xanthomonas campestris pv. campestris [TaxId:340] [187742] (1 PDB entry)
  8. 2887530Domain d2gbza_: 2gbz A: [164664]
    automated match to d1ytaa1
    complexed with mg

Details for d2gbza_

PDB Entry: 2gbz (more details), 2.3 Å

PDB Description: the crystal structure of xc847 from xanthomonas campestris: a 3-5 oligoribonuclease of dnaq fold family with a novel opposingly-shifted helix
PDB Compounds: (A:) Oligoribonuclease

SCOPe Domain Sequences for d2gbza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbza_ c.55.3.0 (A:) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]}
ndrliwidlemtgldtdrdsiieiativtdaqlnvlaegpelaiahsletleamdewnrn
qhrrsglwqrvldsqvthaqaeaqtvaflgewiragaspmcgnsicqdrrflhrqmsrle
ryfhyrnldvstikelarrwapavasgfakssahtalsdvrdsidelrhyrqfmgtlgg

SCOPe Domain Coordinates for d2gbza_:

Click to download the PDB-style file with coordinates for d2gbza_.
(The format of our PDB-style files is described here.)

Timeline for d2gbza_: