Lineage for d2g81i1 (2g81 I:17-72)
- Root: SCOP 1.75
Class g: Small proteins [56992] (90 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) 
Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein) Protein Bowman-Birk inhibitor, BBI [57249] (10 species)
duplication: consists of two sequence repeats each having this fold
Species Cowpea (Vigna unguiculata) [TaxId:3917] [161126] (2 PDB entries)
Uniprot P17734 17-72! Uniprot Q84X88 44-100
Domain d2g81i1: 2g81 I:17-72 [145187]
Other proteins in same PDB: d2g81e1
complexed with acy, ca, edo, p6g, pge, so4
Details for d2g81i1
PDB Entry: 2g81 (more details), 1.55 Å
PDB Description: Crystal Structure of the Bowman-Birk Inhibitor from Vigna unguiculata Seeds in Complex with Beta-trypsin at 1.55 Angstrons Resolution
PDB Compounds: (I:) Bowman-Birk type seed trypsin and chymotrypsin inhibitorSCOP Domain Sequences for d2g81i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g81i1 g.3.13.1 (I:17-72) Bowman-Birk inhibitor, BBI {Cowpea (Vigna unguiculata) [TaxId: 3917]}
pccdrcectksippqcrcsdvrlnschsackscactfsipaqcfcgdindfcykpc
SCOP Domain Coordinates for d2g81i1:
Click to download the PDB-style file with coordinates for d2g81i1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2g81i1:
- d2g81i1 is new in SCOP 1.75
- d2g81i1 appears in SCOPe 2.01
- d2g81i1 appears in the current release, SCOPe 2.08
View in 3D
