Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Cow (Bos taurus) [TaxId:9913] [50516] (279 PDB entries) Uniprot P00760 |
Domain d2g81e1: 2g81 E:16-245 [134745] Other proteins in same PDB: d2g81i1 automatically matched to d1tgsz_ complexed with acy, ca, edo, p6g, pge, so4 |
PDB Entry: 2g81 (more details), 1.55 Å
SCOP Domain Sequences for d2g81e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g81e1 b.47.1.2 (E:16-245) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
Timeline for d2g81e1: