Lineage for d2g3pa1 (2g3p A:2-67)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786733Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily)
    core: barrel, in some members open; n*=4, S*=8; meander
  4. 2786734Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (2 families) (S)
  5. 2786735Family b.37.1.1: N-terminal domains of the minor coat protein g3p [50177] (3 proteins)
  6. 2786742Protein N-terminal domains of the minor coat protein g3p, N-terminal domain [418916] (2 species)
    protein duplication: the two domains share a common fold
  7. 2786743Species Bacteriophage fd [TaxId:10864] [419340] (2 PDB entries)
  8. 2786744Domain d2g3pa1: 2g3p A:2-67 [24791]
    Other proteins in same PDB: d2g3pa2, d2g3pa3, d2g3pb2, d2g3pb3

Details for d2g3pa1

PDB Entry: 2g3p (more details), 1.9 Å

PDB Description: structure of the n-terminal two domains of the infectivity protein g3p of filamentous phage fd
PDB Compounds: (A:) infectivity protein g3p

SCOPe Domain Sequences for d2g3pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3pa1 b.37.1.1 (A:2-67) N-terminal domains of the minor coat protein g3p, N-terminal domain {Bacteriophage fd [TaxId: 10864]}
etvesclakphtensftnvwkddktldryanyegclwnatgvvvctgdetqcygtwvpig
laipen

SCOPe Domain Coordinates for d2g3pa1:

Click to download the PDB-style file with coordinates for d2g3pa1.
(The format of our PDB-style files is described here.)

Timeline for d2g3pa1: