SCOPe 2.08: Domain d2g3pa2: 2g3p A:90-217

Lineage for d2g3pa2 (2g3p A:90-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily)
   core: barrel, in some members open; n*=4, S*=8; meander

4. Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (2 families)

5. Family b.37.1.1: N-terminal domains of the minor coat protein g3p [50177] (3 proteins)

6. Protein N-terminal domains of the minor coat protein g3p, C-terminal domain [418917] (2 species)
   protein duplication: the two domains share a common fold

7. Species Bacteriophage fd [TaxId:10864] [419341] (1 PDB entry)

8. Domain d2g3pa2: 2g3p A:90-217 [24792]
   Other proteins in same PDB: d2g3pa1, d2g3pa3, d2g3pb1, d2g3pb3
   has additional insertions and/or extensions that are not grouped together

Details for d2g3pa2

PDB Entry: 2g3p, 1.9 Å

PDB Description: structure of the n-terminal two domains of the infectivity protein g3p of filamentous phage fd

PDB Compounds: (A:) infectivity protein g3p

SCOPe Domain Sequences for d2g3pa2:

Sequence; same for both SEQRES and ATOM records:

>d2g3pa2 b.37.1.1 (A:90-217) N-terminal domains of the minor coat protein g3p, C-terminal domain {Bacteriophage fd [TaxId: 10864]}
peygdtpipgytyinpldgtyppgteqnpanpnpsleesqplntfmfqnnrfrnrqgalt
vytgtvtqgtdpvktyyqytpvsskamydaywngkfrdcafhsgfnedpfvceyqgqssd
lpqppvna

Timeline for d2g3pa2:

• d2g3pa2 first appeared (with stable ids) in SCOP 1.55
  
• d2g3pa2 appears in SCOPe 2.07