Lineage for d2fyxa1 (2fyx A:2-130)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2956175Superfamily d.58.57: Transposase IS200-like [143422] (1 family) (S)
    contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
    automatically mapped to Pfam PF01797
  5. 2956176Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
    Pfam PF01797
  6. 2956193Protein Putative transposase DR0177 [143428] (1 species)
  7. 2956194Species Deinococcus radiodurans [TaxId:1299] [143429] (1 PDB entry)
    Uniprot Q9RXX8 1-130
  8. 2956195Domain d2fyxa1: 2fyx A:2-130 [134411]
    Other proteins in same PDB: d2fyxa2, d2fyxb3
    complexed with gol

Details for d2fyxa1

PDB Entry: 2fyx (more details), 1.9 Å

PDB Description: crystal structure of a putative transposase (dr_0177) from deinococcus radiodurans r1 at 1.90 a resolution
PDB Compounds: (A:) Transposase, putative

SCOPe Domain Sequences for d2fyxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyxa1 d.58.57.1 (A:2-130) Putative transposase DR0177 {Deinococcus radiodurans [TaxId: 1299]}
kkgrgyvykleyhliwatkyrhqvlvdevadglkdilrdiatqnglelvalevmpdyvhl
llgatpqhvipdfvkalkgasarrmfsafphlkqphwggnlwnpsycvltvsehtraqiq
qyienqhaa

SCOPe Domain Coordinates for d2fyxa1:

Click to download the PDB-style file with coordinates for d2fyxa1.
(The format of our PDB-style files is described here.)

Timeline for d2fyxa1:

2956195
d2fyxa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2fyxa2