SCOPe 2.08: Domain d2fyxb2: 2fyx B:2-130

Lineage for d2fyxb2 (2fyx B:2-130)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.57: Transposase IS200-like [143422] (1 family)
   contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
   automatically mapped to Pfam PF01797

5. Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
   Pfam PF01797

6. Protein Putative transposase DR0177 [143428] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [143429] (1 PDB entry)
   Uniprot Q9RXX8 1-130

8. Domain d2fyxb2: 2fyx B:2-130 [134412]
   Other proteins in same PDB: d2fyxa2, d2fyxb3
   automated match to d2fyxa1
   complexed with gol

Details for d2fyxb2

PDB Entry: 2fyx, 1.9 Å

PDB Description: crystal structure of a putative transposase (dr_0177) from deinococcus radiodurans r1 at 1.90 a resolution

PDB Compounds: (B:) Transposase, putative

SCOPe Domain Sequences for d2fyxb2:

Sequence; same for both SEQRES and ATOM records:

>d2fyxb2 d.58.57.1 (B:2-130) Putative transposase DR0177 {Deinococcus radiodurans [TaxId: 1299]}
kkgrgyvykleyhliwatkyrhqvlvdevadglkdilrdiatqnglelvalevmpdyvhl
llgatpqhvipdfvkalkgasarrmfsafphlkqphwggnlwnpsycvltvsehtraqiq
qyienqhaa

Timeline for d2fyxb2:

• d2fyxb2 first appeared in SCOP 1.73, called d2fyxb1
  
• d2fyxb2 appears in SCOPe 2.07