Lineage for d2fy6a1 (2fy6 A:33-175)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877624Protein Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain [142385] (2 species)
  7. 2877627Species Neisseria meningitidis serogroup A [TaxId:65699] [142386] (4 PDB entries)
    Uniprot Q9JWM8 33-175
  8. 2877628Domain d2fy6a1: 2fy6 A:33-175 [134344]
    complexed with cl, so4

Details for d2fy6a1

PDB Entry: 2fy6 (more details), 1.9 Å

PDB Description: structure of the n-terminal domain of neisseria meningitidis pilb
PDB Compounds: (A:) Peptide methionine sulfoxide reductase msrA/msrB

SCOPe Domain Sequences for d2fy6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]}
vphtlstlktadnrpasvylkkdkptlikfwaswcplclselgqtekwaqdakfssanli
tvaspgflhekkdgdfqkwyaglnypklpvvtdnggtiaqslnisvypswaligkdgdvq
rivkgsineaqalalirdpnadl

SCOPe Domain Coordinates for d2fy6a1:

Click to download the PDB-style file with coordinates for d2fy6a1.
(The format of our PDB-style files is described here.)

Timeline for d2fy6a1: