Lineage for d2fola1 (2fol A:5-173)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124776Protein Rab1a [142241] (1 species)
  7. 2124777Species Human (Homo sapiens) [TaxId:9606] [142242] (3 PDB entries)
    Uniprot P62820 7-175
  8. 2124778Domain d2fola1: 2fol A:5-173 [133883]
    complexed with gdp, mg, unx

Details for d2fola1

PDB Entry: 2fol (more details), 2.63 Å

PDB Description: crystal structure of human rab1a in complex with gdp
PDB Compounds: (A:) Ras-related protein Rab-1A

SCOPe Domain Sequences for d2fola1:

Sequence, based on SEQRES records: (download)

>d2fola1 c.37.1.8 (A:5-173) Rab1a {Human (Homo sapiens) [TaxId: 9606]}
ydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwdt
agqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnkcd
lttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm

Sequence, based on observed residues (ATOM records): (download)

>d2fola1 c.37.1.8 (A:5-173) Rab1a {Human (Homo sapiens) [TaxId: 9606]}
ydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwdy
rgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnkcdlttkkvvdyttake
fadslgipfletsaknatnveqsfmtmaaeikkrm

SCOPe Domain Coordinates for d2fola1:

Click to download the PDB-style file with coordinates for d2fola1.
(The format of our PDB-style files is described here.)

Timeline for d2fola1: