Lineage for d2fh7a2 (2fh7 A:1697-1942)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) 
share with the family I the common active site structure with a circularly permuted topology
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
has an extension to the beta-sheet of 3 antiparallel strands before strand 4
Protein automated matches [190252] (5 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187034] (47 PDB entries) 
Domain d2fh7a2: 2fh7 A:1697-1942 [230733]
automated match to d1lara2
Details for d2fh7a2
PDB Entry: 2fh7 (more details), 2 Å
PDB Description: crystal structure of the phosphatase domains of human ptp sigma
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase SSCOPe Domain Sequences for d2fh7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fh7a2 c.45.1.2 (A:1697-1942) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fisanlpcnkfknrlvnimpyestrvclqpirgvegsdyinasfidgyrqqkayiatqgp
laettedfwrmlwennstivvmltklremgrekchqywpaersaryqyfvvdpmaeynmp
qyilrefkvtdardgqsrtvrqfqftdwpeqgvpksgegfidfigqvhktkeqfgqdgpi
svhcsagvgrtgvfitlsivlermryegvvdifqtvkmlrtqrpamvqtedeyqfcyqaa
leylgs
SCOPe Domain Coordinates for d2fh7a2:
Click to download the PDB-style file with coordinates for d2fh7a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fh7a2:
- d2fh7a2 first appeared in SCOPe 2.03
- d2fh7a2 appears in SCOPe 2.07
View in 3D
