Lineage for d2fgea4 (2fge A:15-271)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611057Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2611058Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2611059Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 2611285Protein Presequence protease 1, PREP1 [143498] (1 species)
    duplication: comprises four domains of this fold; similar to the MPP alpha-beta heterodimer
  7. 2611286Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [143499] (1 PDB entry)
    Uniprot Q9LJL3 100-356! Uniprot Q9LJL3 357-624! Uniprot Q9LJL3 625-882! Uniprot Q9LJL3 883-1078
  8. 2611290Domain d2fgea4: 2fge A:15-271 [133433]
    complexed with cl, mg, zn

Details for d2fgea4

PDB Entry: 2fge (more details), 2.1 Å

PDB Description: crystal structure of presequence protease prep from arabidopsis thaliana
PDB Compounds: (A:) zinc metalloprotease (insulinase family)

SCOPe Domain Sequences for d2fgea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgea4 d.185.1.1 (A:15-271) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
deaeklgfekvseefiseckskailfkhkktgcevmsvsnedenkvfgvvfrtppkdstg
iphilqhsvlcgsrkypvkepfvellkgslhtflnaftypdrtcypvastntkdfynlvd
vyldavffpkcvddahtfqqegwhyelndpsedisykgvvfnemkgvysqpdnilgriaq
qalspentygvdsggdpkdipnltfeefkefhrqyyhpsnariwfygdddpvhrlrvlse
yldmfeaspspnsskik

SCOPe Domain Coordinates for d2fgea4:

Click to download the PDB-style file with coordinates for d2fgea4.
(The format of our PDB-style files is described here.)

Timeline for d2fgea4: