Lineage for d2fbma1 (2fbm A:282-532)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. Protein Chromodomain protein CDY1, C-terminal domain [142008] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [142009] (1 PDB entry)
    Uniprot Q9Y6F8 282-532
  8. Domain d2fbma1: 2fbm A:282-532 [133251]
    complexed with cl

Details for d2fbma1

PDB Entry: 2fbm (more details), 2.28 Å

PDB Description: Acetyltransferase domain of CDY1
PDB Compounds: (A:) Y chromosome chromodomain protein 1, telomeric isoform b

SCOPe Domain Sequences for d2fbma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbma1 c.14.1.3 (A:282-532) Chromodomain protein CDY1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tyrdivvkkedgftqivlstrsteknalntevikeivnalnsaaaddsklvlfsaagsvf
ccgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilpl
cdlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakgl
vsqvfltgtftqevmiqikelasynpivleeckalvrcnikleleqanerecevlrkiws
saqgiesmlki

SCOPe Domain Coordinates for d2fbma1 are not available.

Timeline for d2fbma1:

Domains from other chains:
(mouse over for more information)
d2fbmb_, d2fbmc_