![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.3: Chromo barrel domain [117157] (4 proteins) typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain |
![]() | Protein Mortality factor 4-like protein 1, MRG15 [141225] (1 species) MORF-related gene 15 isoform 1 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141226] (1 PDB entry) Uniprot Q9UBU8 6-88 |
![]() | Domain d2f5kb_: 2f5k B: [132996] automated match to d2efia1 |
PDB Entry: 2f5k (more details), 2.2 Å
SCOPe Domain Sequences for d2f5kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5kb_ b.34.13.3 (B:) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky vdtnlqkqrelqkanqeqyaegkmr
Timeline for d2f5kb_: