Lineage for d2f1fa2 (2f1f A:78-163)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.18: ACT-like [55021] (15 families) 
regulatory domain linked to a wide range of metabolic enzymes
Family d.58.18.6: IlvH-like [143376] (2 proteins)
Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modesProtein Acetolactate synthase small subunit, IlvH [143377] (3 species) Species Escherichia coli [TaxId:562] [143379] (1 PDB entry)
Uniprot P00894 2-77! Uniprot P00894 78-163
Domain d2f1fa2: 2f1f A:78-163 [132761]
complexed with 1pe, mg, p33
Details for d2f1fa2
PDB Entry: 2f1f (more details), 1.75 Å
PDB Description: crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme iii from e. coli
PDB Compounds: (A:) Acetolactate synthase isozyme III small subunitSCOPe Domain Sequences for d2f1fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1fa2 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]}
qgahvereimlvkiqasgygrdevkrnteifrgqiidvtpslytvqlagtsgkldaflas
irdvakivevarsgvvglsrgdkimr
SCOPe Domain Coordinates for d2f1fa2:
Click to download the PDB-style file with coordinates for d2f1fa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f1fa2:
- d2f1fa2 first appeared in SCOP 1.73
- d2f1fa2 appears in SCOPe 2.07
View in 3D
