PDB entry 2f1f

View 2f1f on RCSB PDB site
Description: Crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme III from E. coli
Class: transferase
Keywords: ferredoxin fold, ACT domain, TRANSFERASE
Deposited on 2005-11-14, released 2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetolactate synthase isozyme III small subunit
    Species: Escherichia coli [TaxId:562]
    Gene: ilvH, brnP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00894 (Start-163)
      • see remark 999 (1)
    Domains in SCOPe 2.07: d2f1fa1, d2f1fa2
  • Chain 'B':
    Compound: Acetolactate synthase isozyme III small subunit
    Species: Escherichia coli [TaxId:562]
    Gene: ilvH, brnP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00894
      • see remark 999 (1)
    Domains in SCOPe 2.07: d2f1fb1, d2f1fb2
  • Heterogens: MG, 1PE, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f1fA (A:)
    marrilsvllenesgalsrviglfsqrgyniesltvaptddptlsrmtiqtvgdekvleq
    iekqlhklvdvlrvselgqgahvereimlvkiqasgygrdevkrnteifrgqiidvtpsl
    ytvqlagtsgkldaflasirdvakivevarsgvvglsrgdkimr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1fA (A:)
    arrilsvllenesgalsrviglfsqrgyniesltvaptddptlsrmtiqtvgdekvleqi
    ekqlhklvdvlrvselgqgahvereimlvkiqasgygrdevkrnteifrgqiidvtpsly
    tvqlagtsgkldaflasirdvakivevarsgvvglsrgdkimr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f1fB (B:)
    marrilsvllenesgalsrviglfsqrgyniesltvaptddptlsrmtiqtvgdekvleq
    iekqlhklvdvlrvselgqgahvereimlvkiqasgygrdevkrnteifrgqiidvtpsl
    ytvqlagtsgkldaflasirdvakivevarsgvvglsrgdkimr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1fB (B:)
    arrilsvllenesgalsrviglfsqrgyniesltvaptddptlsrmtiqtvgdekvleqi
    ekqlhklvdvlrvselgqgahvereimlvkiqasgygrdevkrnteifrgqiidvtpsly
    tvqlagtsgkldaflasirdvakivevarsgvvglsrg