Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) |
Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins) barrel, closed; n=5, S=10 |
Protein Staphylococcal nuclease [50201] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [50202] (197 PDB entries) Uniprot P00644 89-223 |
Domain d2f0ea_: 2f0e A: [164229] automated match to d1joka_ mutant |
PDB Entry: 2f0e (more details), 1.95 Å
SCOPe Domain Sequences for d2f0ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f0ea_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]} lhkepatlikaidgdtlklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr kseaqakkeklniws
Timeline for d2f0ea_: