![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.11: BT0572-like [143395] (1 protein) duplication: tandem repeat of two ACT-like domains; dimerizes with the formation of orthogonally packed intersubunit beta-sheets |
![]() | Protein Hypothetical protein BT0572 [143396] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [143397] (1 PDB entry) Uniprot Q8AA93 1-70! Uniprot Q8AA93 71-141 |
![]() | Domain d2f06a1: 2f06 A:71-141 [132652] Other proteins in same PDB: d2f06a3, d2f06b3 complexed with his |
PDB Entry: 2f06 (more details), 2.1 Å
SCOPe Domain Sequences for d2f06a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} vvgiscpnvpgalakvlgflsaegvfieymysfannnvanvvirpsnmdkcievlkekkv dllaasdlykl
Timeline for d2f06a1: