Lineage for d2f06a1 (2f06 A:71-141)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954231Family d.58.18.11: BT0572-like [143395] (1 protein)
    duplication: tandem repeat of two ACT-like domains; dimerizes with the formation of orthogonally packed intersubunit beta-sheets
  6. 2954232Protein Hypothetical protein BT0572 [143396] (1 species)
  7. 2954233Species Bacteroides thetaiotaomicron [TaxId:818] [143397] (1 PDB entry)
    Uniprot Q8AA93 1-70! Uniprot Q8AA93 71-141
  8. 2954234Domain d2f06a1: 2f06 A:71-141 [132652]
    Other proteins in same PDB: d2f06a3, d2f06b3
    complexed with his

Details for d2f06a1

PDB Entry: 2f06 (more details), 2.1 Å

PDB Description: Crystal structure of protein BT0572 from Bacteroides thetaiotaomicron
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2f06a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]}
vvgiscpnvpgalakvlgflsaegvfieymysfannnvanvvirpsnmdkcievlkekkv
dllaasdlykl

SCOPe Domain Coordinates for d2f06a1:

Click to download the PDB-style file with coordinates for d2f06a1.
(The format of our PDB-style files is described here.)

Timeline for d2f06a1: