Lineage for d2exna1 (2exn A:1-120)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.165: MOSC N-terminal domain-like [141672] (1 superfamily)
complex fold; comprises a beta-hairpin and a meander 3-stranded sheet packed against beta-barrel: closed, n=5, S=8; contains three short helicesSuperfamily b.165.1: MOSC N-terminal domain-like [141673] (1 family) 
Family b.165.1.1: MOSC N-terminal domain-like [141674] (1 protein)
Pfam PF03476Protein Hypothetical protein BB0938 [141675] (1 species) Species Bordetella bronchiseptica [TaxId:518] [141676] (2 PDB entries)
Uniprot Q7WNU7 1-128
Domain d2exna1: 2exn A:1-120 [132562]
Other proteins in same PDB: d2exna2
Details for d2exna1
PDB Entry: 2exn (more details)
PDB Description: solution structure for the protein coded by gene locus bb0938 of bordetella bronchiseptica. northeast structural genomics target bor11.
PDB Compounds: (A:) Hypothetical protein BoR11SCOPe Domain Sequences for d2exna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exna1 b.165.1.1 (A:1-120) Hypothetical protein BB0938 {Bordetella bronchiseptica [TaxId: 518]}
msttayqpiaecgattqseaaayqkrwlvandagqwlnrdlcprlaevsvelrmgylvlk
apgmlrldipldviedddsvryqmlvgeqtvdvvdegelaaawisnhagvpcrilkvhpd
SCOPe Domain Coordinates for d2exna1:
Click to download the PDB-style file with coordinates for d2exna1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2exna1:
- d2exna1 first appeared in SCOP 1.73
- d2exna1 appears in SCOPe 2.07
View in 3D
