PDB entry 2exn

View 2exn on RCSB PDB site
Description: Solution structure for the protein coded by gene locus BB0938 of Bordetella bronchiseptica. Northeast Structural Genomics target BoR11.
Class: structural genomics, unknown function
Keywords: Beta barrel containing fold; AutoStructure; AutoAssign; NMR structure; BoR11, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2005-11-08, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein BoR11
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WNU7 (0-119)
      • expression tag (120-129)
    Domains in SCOPe 2.08: d2exna1, d2exna2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2exnA (A:)
    msttayqpiaecgattqseaaayqkrwlvandagqwlnrdlcprlaevsvelrmgylvlk
    apgmlrldipldviedddsvryqmlvgeqtvdvvdegelaaawisnhagvpcrilkvhpd
    maevrwpslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2exnA (A:)
    msttayqpiaecgattqseaaayqkrwlvandagqwlnrdlcprlaevsvelrmgylvlk
    apgmlrldipldviedddsvryqmlvgeqtvdvvdegelaaawisnhagvpcrilkvhpd
    maevrwpsle