Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) duplication: contains two helix-hairpin-helix (HhH) motifs |
Family a.60.2.7: ComEA-like [158534] (2 proteins) sequence similarity to the HhH-motif domains of the PsbU-like and Tex-like families |
Protein KIF22, C-terminal domain [158537] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158538] (1 PDB entry) Uniprot Q14807 570-660 |
Domain d2edua1: 2edu A:8-98 [146805] |
PDB Entry: 2edu (more details)
SCOP Domain Sequences for d2edua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ekaedcwelqispellahgrqkildllnegsardlrslqrigpkkaqlivgwrelhgpfs qvedlervegitgkqmesflkanilglaagq
Timeline for d2edua1: