Lineage for d2edua1 (2edu A:8-98)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 770939Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 771013Family a.60.2.7: ComEA-like [158534] (2 proteins)
    sequence similarity to the HhH-motif domains of the PsbU-like and Tex-like families
  6. 771014Protein KIF22, C-terminal domain [158537] (1 species)
  7. 771015Species Human (Homo sapiens) [TaxId:9606] [158538] (1 PDB entry)
    Uniprot Q14807 570-660
  8. 771016Domain d2edua1: 2edu A:8-98 [146805]

Details for d2edua1

PDB Entry: 2edu (more details)

PDB Description: solution structure of rsgi ruh-070, a c-terminal domain of kinesin- like protein kif22 from human cdna
PDB Compounds: (A:) Kinesin-like protein KIF22

SCOP Domain Sequences for d2edua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ekaedcwelqispellahgrqkildllnegsardlrslqrigpkkaqlivgwrelhgpfs
qvedlervegitgkqmesflkanilglaagq

SCOP Domain Coordinates for d2edua1:

Click to download the PDB-style file with coordinates for d2edua1.
(The format of our PDB-style files is described here.)

Timeline for d2edua1: