SCOPe 2.08: Domain d2edua1: 2edu A:8-98

Lineage for d2edua1 (2edu A:8-98)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (7 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.7: ComEA-like [158534] (2 proteins)
   sequence similarity to the HhH-motif domains of the PsbU-like and Tex-like families

6. Protein KIF22, C-terminal domain [158537] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158538] (1 PDB entry)
   Uniprot Q14807 570-660

8. Domain d2edua1: 2edu A:8-98 [146805]
   Other proteins in same PDB: d2edua2

Details for d2edua1

PDB Entry: 2edu

PDB Description: solution structure of rsgi ruh-070, a c-terminal domain of kinesin- like protein kif22 from human cdna

PDB Compounds: (A:) Kinesin-like protein KIF22

SCOPe Domain Sequences for d2edua1:

Sequence; same for both SEQRES and ATOM records:

>d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ekaedcwelqispellahgrqkildllnegsardlrslqrigpkkaqlivgwrelhgpfs
qvedlervegitgkqmesflkanilglaagq

Timeline for d2edua1:

• d2edua1 first appeared in SCOP 1.75
  
• d2edua1 appears in SCOPe 2.07