Lineage for d2dj4a1 (2dj4 A:8-108)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (27 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
Pfam PF00630
Protein Filamin b [141025] (1 species) Species Human (Homo sapiens) [TaxId:9606] [141026] (17 PDB entries)
Uniprot O75369 1017-1134! Uniprot O75369 1130-1229! Uniprot O75369 1215-1329! Uniprot O75369 1325-1442! Uniprot O75369 1418-1518! Uniprot O75369 1611-1721! Uniprot O75369 1899-2001! Uniprot O75369 1999-2096! Uniprot O75369 2104-2192
Domain d2dj4a1: 2dj4 A:8-108 [131535]
Other proteins in same PDB: d2dj4a2
13th repeat
Details for d2dj4a1
PDB Entry: 2dj4 (more details)
PDB Description: solution structure of the 13th filamin domain from human filamin-b
PDB Compounds: (A:) Filamin-BSCOPe Domain Sequences for d2dj4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]}
vvdpskvkiagpglgsgvrarvlqsftvdsskaglaplevrvlgprglvepvnvvdngdg
thtvtytpsqegpymvsvkyadeeiprspfkvkvlptydas
SCOPe Domain Coordinates for d2dj4a1:
Click to download the PDB-style file with coordinates for d2dj4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dj4a1:
- d2dj4a1 first appeared in SCOP 1.73
- d2dj4a1 appears in SCOPe 2.07
View in 3D
