Class b: All beta proteins [48724] (176 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (3 families) |
Family b.68.6.1: SGL-like [63830] (4 proteins) |
Protein Lactonase Drp35 [141546] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [141547] (2 PDB entries) Uniprot Q7A338 5-324! Uniprot Q99QV3 5-324 |
Domain d2dg0a1: 2dg0 A:5-324 [131481] Other proteins in same PDB: d2dg0b_, d2dg0c_, d2dg0d_, d2dg0e_, d2dg0f_, d2dg0g_, d2dg0h_, d2dg0i_, d2dg0j_, d2dg0k_, d2dg0l_ |
PDB Entry: 2dg0 (more details), 2.4 Å
SCOPe Domain Sequences for d2dg0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dg0a1 b.68.6.1 (A:5-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} qqdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvf egnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnl qdiiedlstayciddmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisva ngialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsdd nlyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemg ggsmlytvngfakghqsfqf
Timeline for d2dg0a1: