Lineage for d2dg0a1 (2dg0 A:5-324)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553917Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1554505Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (3 families) (S)
  5. 1554506Family b.68.6.1: SGL-like [63830] (4 proteins)
  6. 1554530Protein Lactonase Drp35 [141546] (1 species)
  7. 1554531Species Staphylococcus aureus [TaxId:1280] [141547] (2 PDB entries)
    Uniprot Q7A338 5-324! Uniprot Q99QV3 5-324
  8. 1554533Domain d2dg0a1: 2dg0 A:5-324 [131481]
    Other proteins in same PDB: d2dg0b_, d2dg0c_, d2dg0d_, d2dg0e_, d2dg0f_, d2dg0g_, d2dg0h_, d2dg0i_, d2dg0j_, d2dg0k_, d2dg0l_

Details for d2dg0a1

PDB Entry: 2dg0 (more details), 2.4 Å

PDB Description: Crystal structure of Drp35, a 35kDa drug responsive protein from Staphylococcus aureus
PDB Compounds: (A:) DrP35

SCOPe Domain Sequences for d2dg0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dg0a1 b.68.6.1 (A:5-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}
qqdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvf
egnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnl
qdiiedlstayciddmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisva
ngialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsdd
nlyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemg
ggsmlytvngfakghqsfqf

SCOPe Domain Coordinates for d2dg0a1:

Click to download the PDB-style file with coordinates for d2dg0a1.
(The format of our PDB-style files is described here.)

Timeline for d2dg0a1: