Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.8: SMR domain-like [160443] (1 family) automatically mapped to Pfam PF01713 |
Family d.68.8.1: Smr domain [160444] (2 proteins) Pfam PF01713 |
Protein Nedd4-binding protein 2 [160445] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160446] (1 PDB entry) Uniprot Q86UW6 1688-1770 |
Domain d2d9ia1: 2d9i A:8-90 [146475] Other proteins in same PDB: d2d9ia2, d2d9ia3 |
PDB Entry: 2d9i (more details)
SCOPe Domain Sequences for d2d9ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d9ia1 d.68.8.1 (A:8-90) Nedd4-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} qnvldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgnhsqggvarikpavi kylishsfrfseikpgclkvmlk
Timeline for d2d9ia1: