| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
| Protein automated matches [190743] (3 species) not a true protein |
| Species Pyrococcus horikoshii [TaxId:70601] [225180] (1 PDB entry) |
| Domain d2d7ja_: 2d7j A: [203940] automated match to d1wl8a1 |
PDB Entry: 2d7j (more details), 1.89 Å
SCOPe Domain Sequences for d2d7ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d7ja_ c.23.16.1 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mivimdnggqyvhriwrtlrylgvetkiipnttpleeikamnpkgiifsggpslentgnc
ekvlehydefnvpilgiclghqliakffggkvgrgekaeyslveieiidedeifkglpkr
lkvweshmdevkelppkfkilarsetcpieamkheelpiygvqfhpevahtekgeeilrn
faklcgel
Timeline for d2d7ja_: