SCOPe 2.07: Domain d2d1pa1: 2d1p A:1-128

Lineage for d2d1pa1 (2d1p A:1-128)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.114: DsrEFH-like [75168] (1 superfamily)
3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
Superfamily c.114.1: DsrEFH-like [75169] (3 families)
Family c.114.1.1: DsrEF-like [75170] (6 proteins)
Pfam PF02635
Protein tRNA 2-thiouridine synthesizing protein D, TusD [142100] (1 species)
formerly hypothetical protein YheN
Species Escherichia coli [TaxId:562] [142101] (1 PDB entry)
Uniprot P45532 1-128
Domain d2d1pa1: 2d1p A:1-128 [131136]
Other proteins in same PDB: d2d1pa2, d2d1pb1, d2d1pc1, d2d1pd3, d2d1pe_, d2d1pf_, d2d1pg3, d2d1ph_, d2d1pi_
complexed with so4

Details for d2d1pa1

PDB Entry: 2d1p (more details), 2.15 Å

PDB Description: crystal structure of heterohexameric TusBCD proteins, which are crucial for the tRNA modification

PDB Compounds: (A:) Hypothetical UPF0163 protein yheN

SCOPe Domain Sequences for d2d1pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1pa1 c.114.1.1 (A:1-128) tRNA 2-thiouridine synthesizing protein D, TusD {Escherichia coli [TaxId: 562]}
mrfaivvtgpaygtqqassafqfaqaliadghelssvffyregvynanqltspasdefdl
vrawqqlnaqhgvalnicvaaalrrgvvdeteagrlglassnlqqgftlsglgalaeasl
tcdrvvqf

SCOPe Domain Coordinates for d2d1pa1:

Click to download the PDB-style file with coordinates for d2d1pa1.
(The format of our PDB-style files is described here.)

Timeline for d2d1pa1: