Lineage for d2cwya1 (2cwy A:1-94)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351179Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 2351232Superfamily a.246.2: TTHA0068-like [140663] (1 family) (S)
  5. 2351233Family a.246.2.1: TTHA0068-like [140664] (3 proteins)
    Pfam PF03745; DUF309
  6. 2351237Protein Hypothetical protein TTHA0068 [140667] (1 species)
  7. 2351238Species Thermus thermophilus [TaxId:274] [140668] (1 PDB entry)
    Uniprot Q5SM75 1-94
  8. 2351239Domain d2cwya1: 2cwy A:1-94 [130960]

Details for d2cwya1

PDB Entry: 2cwy (more details), 1.85 Å

PDB Description: Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8
PDB Compounds: (A:) hypothetical protein TTHA0068

SCOPe Domain Sequences for d2cwya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwya1 a.246.2.1 (A:1-94) Hypothetical protein TTHA0068 {Thermus thermophilus [TaxId: 274]}
mvpdweevlglwragryyevhevlepywlkatgeerrllqgvillaaalhqrrlgrpglr
nlrkaearleglpcplmgldwrsllqearrrlga

SCOPe Domain Coordinates for d2cwya1:

Click to download the PDB-style file with coordinates for d2cwya1.
(The format of our PDB-style files is described here.)

Timeline for d2cwya1: