Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (19 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (40 proteins) Pfam PF00046 |
Protein Homeobox-containing protein 1, HMBOX1 (Flj21616) [140159] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140160] (1 PDB entry) Uniprot Q6NT76 268-350 |
Domain d2cufa1: 2cuf A:8-89 [130809] |
PDB Entry: 2cuf (more details)
SCOP Domain Sequences for d2cufa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} rgsrftwrkeclavmesyfnenqypdeakreeianacnaviqkpgkklsdlervtslkvy nwfanrrkeikrraniaailes
Timeline for d2cufa1: