SCOP 1.73: Domain d2cufa1: 2cuf A:8-89

Lineage for d2cufa1 (2cuf A:8-89)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (17 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (39 proteins)
   Pfam PF00046

6. Protein Homeobox-containing protein 1, HMBOX1 (Flj21616) [140159] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140160] (1 PDB entry)

8. Domain d2cufa1: 2cuf A:8-89 [130809]

Details for d2cufa1

PDB Entry: 2cuf

PDB Description: solution structure of the homeobox domain of the human hypothetical protein flj21616

PDB Compounds: (A:) FLJ21616 protein

SCOP Domain Sequences for d2cufa1:

Sequence; same for both SEQRES and ATOM records:

>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]}
rgsrftwrkeclavmesyfnenqypdeakreeianacnaviqkpgkklsdlervtslkvy
nwfanrrkeikrraniaailes

Timeline for d2cufa1:

• d2cufa1 is new in SCOP 1.73
  
• d2cufa1 appears in SCOP 1.75
  
• d2cufa1 appears in the current release, SCOPe 2.08