Lineage for d2cr2a1 (2cr2 A:8-153)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1115788Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1115789Superfamily b.8.1: TRAF domain-like [49599] (2 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 1115790Family b.8.1.1: MATH domain [49600] (4 proteins)
  6. 1115791Protein Speckle-type poz protein SPOP [141107] (2 species)
  7. 1115792Species Human (Homo sapiens) [TaxId:9606] [141108] (7 PDB entries)
    Uniprot O43791 28-173
  8. 1115802Domain d2cr2a1: 2cr2 A:8-153 [130732]

Details for d2cr2a1

PDB Entry: 2cr2 (more details)

PDB Description: solution structure of n-terminal domain of speckle-type poz protein
PDB Compounds: (A:) Speckle-type POZ protein

SCOPe Domain Sequences for d2cr2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldean
gllpddkltlfcevsvvqdsvnisgq

SCOPe Domain Coordinates for d2cr2a1:

Click to download the PDB-style file with coordinates for d2cr2a1.
(The format of our PDB-style files is described here.)

Timeline for d2cr2a1: