| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.26: VirB8-like [160029] (2 proteins) Pfam PF04335 |
| Protein Type IV secretion system protein VirB8 [160030] (2 species) |
| Species Agrobacterium tumefaciens [TaxId:358] [160031] (1 PDB entry) Uniprot P17798 92-231 |
| Domain d2cc3a1: 2cc3 A:92-231 [146384] Other proteins in same PDB: d2cc3b_ complexed with mpd |
PDB Entry: 2cc3 (more details), 2.2 Å
SCOPe Domain Sequences for d2cc3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cc3a1 d.17.4.26 (A:92-231) Type IV secretion system protein VirB8 {Agrobacterium tumefaciens [TaxId: 358]}
tqeeavvnaslweyvrlresydadtaqyaydlvsnfsapmvrqnyqqffnypnptspqvi
lgkhgrlevehiasndvtpgvqqirykrtlivdgkmpmastwtatvryekvtslpgrlrl
tnpgglvvtsyqtsedtvsn
Timeline for d2cc3a1: