Lineage for d2cajb1 (2caj B:9-60)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491361Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1491362Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1491569Family a.43.1.0: automated matches [230594] (1 protein)
    not a true family
  6. 1491570Protein automated matches [230595] (4 species)
    not a true protein
  7. 1491576Species Helicobacter pylori [TaxId:85962] [230596] (9 PDB entries)
  8. 1491590Domain d2cajb1: 2caj B:9-60 [230600]
    Other proteins in same PDB: d2caja2, d2cajb2
    automated match to d2bj9a1
    complexed with cl, gol, ni

Details for d2cajb1

PDB Entry: 2caj (more details), 2.35 Å

PDB Description: nikr from helicobacter pylori in closed trans-conformation and nickel bound to 4 intermediary sites
PDB Compounds: (B:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2cajb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cajb1 a.43.1.0 (B:9-60) automated matches {Helicobacter pylori [TaxId: 85962]}
siirfsvslqqnlldeldnriikngyssrselvrdmireklvednwaednpn

SCOPe Domain Coordinates for d2cajb1:

Click to download the PDB-style file with coordinates for d2cajb1.
(The format of our PDB-style files is described here.)

Timeline for d2cajb1:

1491590
d2cajb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2cajb2