Lineage for d2c6ca2 (2c6c A:118-350)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459236Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2459386Superfamily c.8.4: PA domain [52025] (1 family) (S)
  5. 2459387Family c.8.4.1: PA domain [52026] (2 proteins)
  6. 2459388Protein Glutamate carboxypeptidase II [141984] (1 species)
  7. 2459389Species Human (Homo sapiens) [TaxId:9606] [141985] (34 PDB entries)
    Uniprot Q04609 118-350
  8. 2459398Domain d2c6ca2: 2c6c A:118-350 [129990]
    Other proteins in same PDB: d2c6ca1, d2c6ca3
    complexed with 24i, ca, cl, nag, zn

Details for d2c6ca2

PDB Entry: 2c6c (more details), 2 Å

PDB Description: membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with gpi-18431 (s)-2-(4-iodobenzylphosphonomethyl)-pentanedioic acid
PDB Compounds: (A:) glutamate carboxypeptidase II

SCOPe Domain Sequences for d2c6ca2:

Sequence, based on SEQRES records: (download)

>d2c6ca2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn

Sequence, based on observed residues (ATOM records): (download)

>d2c6ca2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgfstqkvkmhihstn

SCOPe Domain Coordinates for d2c6ca2:

Click to download the PDB-style file with coordinates for d2c6ca2.
(The format of our PDB-style files is described here.)

Timeline for d2c6ca2: