Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.4: PA domain [52025] (1 family) |
Family c.8.4.1: PA domain [52026] (2 proteins) |
Protein Glutamate carboxypeptidase II [141984] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141985] (34 PDB entries) Uniprot Q04609 118-350 |
Domain d2c6ca2: 2c6c A:118-350 [129990] Other proteins in same PDB: d2c6ca1, d2c6ca3 complexed with 24i, ca, cl, nag, zn |
PDB Entry: 2c6c (more details), 2 Å
SCOPe Domain Sequences for d2c6ca2:
Sequence, based on SEQRES records: (download)
>d2c6ca2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]} sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn
>d2c6ca2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]} sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi gyydaqkllekmggsappdsswrgslkvpynvgpgfstqkvkmhihstn
Timeline for d2c6ca2: