Lineage for d2c5ra1 (2c5r A:66-129)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351314Fold a.251: Phage replication organizer domain [140712] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2351315Superfamily a.251.1: Phage replication organizer domain [140713] (1 family) (S)
    DNA binding induces further oligomerization
    automatically mapped to Pfam PF06720
  5. 2351316Family a.251.1.1: Phage replication organizer domain [140714] (2 proteins)
    Pfam PF06720
  6. 2351317Protein Early protein gp16.7 [140715] (1 species)
  7. 2351318Species Bacteriophage phi-29 [TaxId:10756] [140716] (1 PDB entry)
    Uniprot P16517 67-130
  8. 2351319Domain d2c5ra1: 2c5r A:66-129 [129944]
    Other proteins in same PDB: d2c5rb_, d2c5rc_, d2c5rd_, d2c5re_, d2c5rf_
    protein/DNA complex

Details for d2c5ra1

PDB Entry: 2c5r (more details), 2.9 Å

PDB Description: the structure of phage phi29 replication organizer protein p16.7 in complex with double stranded dna
PDB Compounds: (A:) early protein p16.7

SCOPe Domain Sequences for d2c5ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5ra1 a.251.1.1 (A:66-129) Early protein gp16.7 {Bacteriophage phi-29 [TaxId: 10756]}
nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr
gslk

SCOPe Domain Coordinates for d2c5ra1:

Click to download the PDB-style file with coordinates for d2c5ra1.
(The format of our PDB-style files is described here.)

Timeline for d2c5ra1: