![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
![]() | Protein automated matches [190475] (10 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries) |
![]() | Domain d2bzla_: 2bzl A: [241395] automated match to d2nz6a_ complexed with edo, so4 |
PDB Entry: 2bzl (more details), 1.65 Å
SCOPe Domain Sequences for d2bzla_:
Sequence, based on SEQRES records: (download)
>d2bzla_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} erfrtlkkkleegmvfteyeqipkkkangifstaalpenaersrirevvpyeenrvelip tkenntgyinashikvvvggaewhyiatqgplphtchdfwqmvweqgvnviamvtaeeeg grtkshrywpklgskhssatygkfkvttkfrtdsvcyattglkvkhllsgqertvwhlqy tdwpdhgcpedvqgflsyleeiqsvrrhtnsmlegtknrhppivvhcsagvgrtgvlils elmiyclehnekvevpmmlrllreqrmfmiqtiaqykfvyqvliqflqns
>d2bzla_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} erfrtlkkklmvfteyeqipkkkangifstaalpenaersrirevvpyeenrveliptke nntgyinashikvvvggaewhyiatqgplphtchdfwqmvweqgvnviamvtaeeeggrt kshrywpkkhssatygkfkvttkfrtdsvcyattglkvkhllsgqertvwhlqytdwpdh gcpedvqgflsyleeiqsvrrhtnsmlegtknrhppivvhcsagvgrtgvlilselmiyc lehnekvevpmmlrllreqrmfmiqtiaqykfvyqvliqflqns
Timeline for d2bzla_: