Lineage for d2bq0b_ (2bq0 B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096148Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
  5. 1096149Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 1096193Protein automated matches [190238] (4 species)
    not a true protein
  7. 1096199Species Human (Homo sapiens) [TaxId:9606] [187008] (24 PDB entries)
  8. 1096219Domain d2bq0b_: 2bq0 B: [163145]
    automated match to d1qjba_

Details for d2bq0b_

PDB Entry: 2bq0 (more details), 2.5 Å

PDB Description: 14-3-3 protein beta (human)
PDB Compounds: (B:) 14-3-3 beta/alpha

SCOPe Domain Sequences for d2bq0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bq0b_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrsswr
vissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfylk
mkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtse

SCOPe Domain Coordinates for d2bq0b_:

Click to download the PDB-style file with coordinates for d2bq0b_.
(The format of our PDB-style files is described here.)

Timeline for d2bq0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bq0a_