Lineage for d2bq0b_ (2bq0 B:)
- Root: SCOPe 2.02
Class a: All alpha proteins [46456] (284 folds) 
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelixSuperfamily a.118.7: 14-3-3 protein [48445] (1 family) 
Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) Protein automated matches [190238] (4 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187008] (24 PDB entries) 
Domain d2bq0b_: 2bq0 B: [163145]
automated match to d1qjba_
Details for d2bq0b_
PDB Entry: 2bq0 (more details), 2.5 Å
PDB Description: 14-3-3 protein beta (human)
PDB Compounds: (B:) 14-3-3 beta/alphaSCOPe Domain Sequences for d2bq0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bq0b_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrsswr
vissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfylk
mkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtse
SCOPe Domain Coordinates for d2bq0b_:
Click to download the PDB-style file with coordinates for d2bq0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bq0b_:
- d2bq0b_ first appeared in SCOPe 2.01
- d2bq0b_ appears in SCOPe 2.03
- d2bq0b_ appears in the current release, SCOPe 2.08
View in 3D
