Lineage for d2bl1a1 (2bl1 A:3-172)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921280Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1921424Protein Hypothetical protein PA4866 [143694] (1 species)
    Putative phosphinothricin acetyltransferase
  7. 1921425Species Pseudomonas aeruginosa [TaxId:287] [143695] (5 PDB entries)
    Uniprot Q9HUU7 3-172! Uniprot Q9HUU7 4-172
  8. 1921431Domain d2bl1a1: 2bl1 A:3-172 [128725]
    complexed with azi, gol, so4

Details for d2bl1a1

PDB Entry: 2bl1 (more details), 2 Å

PDB Description: crystal structure of a putative phosphinothricin acetyltransferase (pa4866) from pseudomonas aeruginosa pac1
PDB Compounds: (A:) putative phosphinothricin n-acetyltransferase pa4866

SCOPe Domain Sequences for d2bl1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bl1a1 d.108.1.1 (A:3-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}
asirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasdaa
gevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaa
iesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap

SCOPe Domain Coordinates for d2bl1a1:

Click to download the PDB-style file with coordinates for d2bl1a1.
(The format of our PDB-style files is described here.)

Timeline for d2bl1a1: