| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) ![]() |
| Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins) |
| Protein Hypothetical protein PA4866 [143694] (1 species) Putative phosphinothricin acetyltransferase |
| Species Pseudomonas aeruginosa [TaxId:287] [143695] (2 PDB entries) |
| Domain d2bl1a1: 2bl1 A:3-172 [128725] complexed with azi, gol, so4 |
PDB Entry: 2bl1 (more details), 2 Å
SCOP Domain Sequences for d2bl1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bl1a1 d.108.1.1 (A:3-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}
asirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasdaa
gevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaa
iesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
Timeline for d2bl1a1: