Lineage for d2bh1x1 (2bh1 X:14-81)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025652Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1025862Superfamily d.52.10: EspE N-terminal domain-like [160246] (1 family) (S)
    contains extra C-terminal helix that packs against shorter N-terminal helix
  5. 1025863Family d.52.10.1: GSPII protein E N-terminal domain-like [160247] (3 proteins)
    Pfam PF05157 (also includes PfamB PB000210)
  6. 1025864Protein General secretion pathway protein E, EpsE [160250] (1 species)
  7. 1025865Species Vibrio cholerae [TaxId:666] [160251] (1 PDB entry)
    Uniprot P37093 14-81
  8. 1025866Domain d2bh1x1: 2bh1 X:14-81 [144990]
    Other proteins in same PDB: d2bh1a1, d2bh1a2, d2bh1b1, d2bh1b2, d2bh1y_
    complexed with ca

Details for d2bh1x1

PDB Entry: 2bh1 (more details), 2.4 Å

PDB Description: x-ray structure of the general secretion pathway complex of the n-terminal domain of epse and the cytosolic domain of epsl of vibrio cholerae
PDB Compounds: (X:) general secretion pathway protein e,

SCOPe Domain Sequences for d2bh1x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bh1x1 d.52.10.1 (X:14-81) General secretion pathway protein E, EpsE {Vibrio cholerae [TaxId: 666]}
irrlpfsfanrfklvldwnedfsqasiyylaplsmealvetkrvvkhafqlielsqaefe
skltqvyq

SCOPe Domain Coordinates for d2bh1x1:

Click to download the PDB-style file with coordinates for d2bh1x1.
(The format of our PDB-style files is described here.)

Timeline for d2bh1x1: